PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco023887.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family FAR1
Protein Properties Length: 70aa    MW: 7705.19 Da    PI: 11.8785
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco023887.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR130.61.1e-0916565090
         FAR1 50 kerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                 k+ + ++++ +gCka+l+vk+++dg+w+v  ++ +Hn +l+
  Aco023887.1 16 KRIKGHQTNICGCKAHLRVKRTNDGNWKVVAFVRKHNSALV 56
                 5566778889***************************8886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-71656IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MFVLKKGNPN QKFGIKRIKG HQTNICGCKA HLRVKRTNDG NWKVVAFVRK HNSALVASPS  60
KAVFFGLIV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.21e-07FAR1-related sequence 4